| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143116.1 | internal | 151 | 3-455(+) |
Amino Acid sequence : | |||
| TSPISDMERLHRIFGMGHTPTDSPLLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFG CWLSGVDINTQQSFEALNPRAVAVVVDPIQS | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,604.889 | ||
| Theoretical pI: | 5.019 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 33.448 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.252 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143116.1 | internal | 151 | 3-455(+) |
Amino Acid sequence : | |||
| TSPISDMERLHRIFGMGHTPTDSPLLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFG CWLSGVDINTQQSFEALNPRAVAVVVDPIQS | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,604.889 | ||
| Theoretical pI: | 5.019 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 33.448 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.252 | ||
| sheet | 0.252 | ||