Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143116.1 | internal | 151 | 3-455(+) |
Amino Acid sequence : | |||
TSPISDMERLHRIFGMGHTPTDSPLLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFG CWLSGVDINTQQSFEALNPRAVAVVVDPIQS | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 16,604.889 | ||
Theoretical pI: | 5.019 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 33.448 | ||
aromaticity | 0.073 | ||
GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.252 | ||
sheet | 0.252 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143116.1 | internal | 151 | 3-455(+) |
Amino Acid sequence : | |||
TSPISDMERLHRIFGMGHTPTDSPLLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHSHPGFG CWLSGVDINTQQSFEALNPRAVAVVVDPIQS | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 16,604.889 | ||
Theoretical pI: | 5.019 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 33.448 | ||
aromaticity | 0.073 | ||
GRAVY | 0.059 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.252 | ||
sheet | 0.252 |