| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143126.1 | internal | 117 | 2-352(+) |
Amino Acid sequence : | |||
| HEHKVESNGNRPKVSMAAASEVGNCLGWAARDASGTLSPHKFDRRVTGSDDVSIKITHCGVCYADVAWTQNRMRDSIYPLVPGHEIVGVVTEIGSSVSHFKIGDNIGVGTYVNSCRD | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,597.938 | ||
| Theoretical pI: | 6.638 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 30.675 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.303 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.291 | ||
| sheet | 0.154 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143126.1 | internal | 117 | 2-352(+) |
Amino Acid sequence : | |||
| HEHKVESNGNRPKVSMAAASEVGNCLGWAARDASGTLSPHKFDRRVTGSDDVSIKITHCGVCYADVAWTQNRMRDSIYPLVPGHEIVGVVTEIGSSVSHFKIGDNIGVGTYVNSCRD | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,597.938 | ||
| Theoretical pI: | 6.638 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 30.675 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.303 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.291 | ||
| sheet | 0.154 | ||