| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143128.1 | 5prime_partial | 109 | 2-331(+) |
Amino Acid sequence : | |||
| RTVFGEQMGLSDKDIVALSGGHTLGRCHKDRSGFEGAWTSNPLIFDNSYFTELLAGQKEGLLQLPSDKALLDDPVFRPLVEKYAADEDAFFADYAEAHMKLSELGFAEA* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,000.268 | ||
| Theoretical pI: | 4.588 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 32.889 | ||
| aromaticity | 0.110 | ||
| GRAVY | -0.269 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.211 | ||
| sheet | 0.339 | ||