Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143135.1 | internal | 146 | 2-439(+) |
Amino Acid sequence : | |||
HEQIKAVKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKF LRRFRMPENAKVEEVRASMENGVLTV | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 13,471.646 | ||
Theoretical pI: | 9.508 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.934 | ||
aromaticity | 0.017 | ||
GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.240 | ||
sheet | 0.364 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143135.1 | internal | 146 | 438-1(-) |
Amino Acid sequence : | |||
TVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSK DDEGSNTREPNPNGTSDILTALICSC | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 13,471.646 | ||
Theoretical pI: | 9.508 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.934 | ||
aromaticity | 0.017 | ||
GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.240 | ||
sheet | 0.364 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143135.1 | 5prime_partial | 121 | 439-74(-) |
Amino Acid sequence : | |||
NGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHTVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIPEIE G* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,471.646 | ||
Theoretical pI: | 9.508 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.934 | ||
aromaticity | 0.017 | ||
GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.240 | ||
sheet | 0.364 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143135.1 | internal | 146 | 2-439(+) |
Amino Acid sequence : | |||
HEQIKAVKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKF LRRFRMPENAKVEEVRASMENGVLTV | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 13,471.646 | ||
Theoretical pI: | 9.508 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.934 | ||
aromaticity | 0.017 | ||
GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.240 | ||
sheet | 0.364 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143135.1 | internal | 146 | 438-1(-) |
Amino Acid sequence : | |||
TVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSK DDEGSNTREPNPNGTSDILTALICSC | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 13,471.646 | ||
Theoretical pI: | 9.508 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.934 | ||
aromaticity | 0.017 | ||
GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.240 | ||
sheet | 0.364 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143135.1 | 5prime_partial | 121 | 439-74(-) |
Amino Acid sequence : | |||
NGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHTVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIPEIE G* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,471.646 | ||
Theoretical pI: | 9.508 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 62.934 | ||
aromaticity | 0.017 | ||
GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.240 | ||
sheet | 0.364 |