| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143135.1 | internal | 146 | 2-439(+) |
Amino Acid sequence : | |||
| HEQIKAVKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKF LRRFRMPENAKVEEVRASMENGVLTV | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 13,471.646 | ||
| Theoretical pI: | 9.508 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.934 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.240 | ||
| sheet | 0.364 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143135.1 | internal | 146 | 438-1(-) |
Amino Acid sequence : | |||
| TVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSK DDEGSNTREPNPNGTSDILTALICSC | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 13,471.646 | ||
| Theoretical pI: | 9.508 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.934 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.240 | ||
| sheet | 0.364 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143135.1 | 5prime_partial | 121 | 439-74(-) |
Amino Acid sequence : | |||
| NGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHTVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIPEIE G* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,471.646 | ||
| Theoretical pI: | 9.508 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.934 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.240 | ||
| sheet | 0.364 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143135.1 | internal | 146 | 2-439(+) |
Amino Acid sequence : | |||
| HEQIKAVKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKF LRRFRMPENAKVEEVRASMENGVLTV | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 13,471.646 | ||
| Theoretical pI: | 9.508 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.934 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.240 | ||
| sheet | 0.364 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143135.1 | internal | 146 | 438-1(-) |
Amino Acid sequence : | |||
| TVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSK DDEGSNTREPNPNGTSDILTALICSC | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 13,471.646 | ||
| Theoretical pI: | 9.508 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.934 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.240 | ||
| sheet | 0.364 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143135.1 | 5prime_partial | 121 | 439-74(-) |
Amino Acid sequence : | |||
| NGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHTVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIPEIE G* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,471.646 | ||
| Theoretical pI: | 9.508 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 62.934 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.240 | ||
| sheet | 0.364 | ||