Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143150.1 | internal | 239 | 1-717(+) |
Amino Acid sequence : | |||
GLTYETGDHVGVYSENCIETVEEAEKLLGYSPDTFFSIHADNEDGGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRS LLEVMAEFPSVKPPLGVFFAAISPRLQPRYYSISSSPRMAPTRVHVTCALVHGPTPTGRIHKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPFRGFL | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 25,811.065 | ||
Theoretical pI: | 6.330 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
Instability index: | 49.080 | ||
aromaticity | 0.092 | ||
GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.301 | ||
sheet | 0.259 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143150.1 | internal | 239 | 1-717(+) |
Amino Acid sequence : | |||
GLTYETGDHVGVYSENCIETVEEAEKLLGYSPDTFFSIHADNEDGGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRS LLEVMAEFPSVKPPLGVFFAAISPRLQPRYYSISSSPRMAPTRVHVTCALVHGPTPTGRIHKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPFRGFL | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 25,811.065 | ||
Theoretical pI: | 6.330 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
Instability index: | 49.080 | ||
aromaticity | 0.092 | ||
GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.301 | ||
sheet | 0.259 |