| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143150.1 | internal | 239 | 1-717(+) |
Amino Acid sequence : | |||
| GLTYETGDHVGVYSENCIETVEEAEKLLGYSPDTFFSIHADNEDGGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRS LLEVMAEFPSVKPPLGVFFAAISPRLQPRYYSISSSPRMAPTRVHVTCALVHGPTPTGRIHKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPFRGFL | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 25,811.065 | ||
| Theoretical pI: | 6.330 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
| Instability index: | 49.080 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.301 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143150.1 | internal | 239 | 1-717(+) |
Amino Acid sequence : | |||
| GLTYETGDHVGVYSENCIETVEEAEKLLGYSPDTFFSIHADNEDGGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRS LLEVMAEFPSVKPPLGVFFAAISPRLQPRYYSISSSPRMAPTRVHVTCALVHGPTPTGRIHKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPFRGFL | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 25,811.065 | ||
| Theoretical pI: | 6.330 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
| Instability index: | 49.080 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.130 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.301 | ||
| sheet | 0.259 | ||