| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143151.1 | internal | 207 | 2-622(+) |
Amino Acid sequence : | |||
| DPGYLNTAPVRSSICYIDGDEGILRYRGYPIEELAESSTFVEVAYLLMYGNLPSHSQLADWEFAIAQHSAVPQGLLDIIQAMPHDAHPMGVLVSAMSALSVFHPDANPALKGQDLYQSKQ VRDKQIARILGKAPTIAAAAYLRLAGRPPVLPSNSLSYSENFLYMLDSLGDRAYKPNPRLARVLDILFILHVEHEMNCSTAAARHLA | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 22,758.784 | ||
| Theoretical pI: | 5.869 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22015 | ||
| Instability index: | 43.520 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.242 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143151.1 | internal | 207 | 2-622(+) |
Amino Acid sequence : | |||
| DPGYLNTAPVRSSICYIDGDEGILRYRGYPIEELAESSTFVEVAYLLMYGNLPSHSQLADWEFAIAQHSAVPQGLLDIIQAMPHDAHPMGVLVSAMSALSVFHPDANPALKGQDLYQSKQ VRDKQIARILGKAPTIAAAAYLRLAGRPPVLPSNSLSYSENFLYMLDSLGDRAYKPNPRLARVLDILFILHVEHEMNCSTAAARHLA | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 22,758.784 | ||
| Theoretical pI: | 5.869 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22015 | ||
| Instability index: | 43.520 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.242 | ||
| sheet | 0.324 | ||