| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143166.1 | 5prime_partial | 169 | 3-512(+) |
Amino Acid sequence : | |||
| TSQEEIKPYMASLTTTSSFALFFTLNLLLFVFATSCSTCPSPIPKPKPKPKPTPCPGTPSTPTPTPSTPSTPTPTPTPSTPSGTGKCPIDTLKLGVCADVLGLIGISIGSKPKTACCSLL GNLANLDAAVCLCTTLRAGILGINLNIPVDLSLLLNYCGKSAPSGFQCS* | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 15,233.661 | ||
| Theoretical pI: | 11.107 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 47.932 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.179 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.306 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143166.1 | complete | 144 | 442-8(-) |
Amino Acid sequence : | |||
| MLRLMPRMPALSVVQRHTAASRFARFPRSEQQAVFGLLPMLMPMRPSTSAHTPSFSVSMGHLPVPDGVLGVGVGVGVDGVLGVGVGVDGVPGHGVGFGFGFGFGMGDGQVLHEVANTKRR RLRVKKRAKEEVVVNEAIYGLISS* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 15,233.661 | ||
| Theoretical pI: | 11.107 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 47.932 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.179 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.306 | ||
| sheet | 0.236 | ||