Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143178.1 | 5prime_partial | 165 | 3-500(+) |
Amino Acid sequence : | |||
EIKPYMASLTTTSSFALFFTLNLLLFVFATSCSTCPSPIPKPKPKPKPTPCPGTPSTPTPTPSTPSTPTPTPTPSTPSGTGKCPIDTLKLGVCADVLGLIGISIGSKPKTACCSLLGNLA NLDAAVCLCTTLRAGILGINLNIPVDLSLLLNYCGKSAPSGFQCS* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 15,146.584 | ||
Theoretical pI: | 11.107 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 46.850 | ||
aromaticity | 0.063 | ||
GRAVY | 0.186 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.301 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143178.1 | 3prime_partial | 143 | 430-2(-) |
Amino Acid sequence : | |||
MLRLMPRMPALSVVQRHTAASRFARFPRSEQQAVFGLLPMLMPMRPSTSAHTPSFSVSMGHLPVPDGVLGVGVGVGVDGVLGVGVGVDGVPGHGVGFGFGFGFGMGDGQVLHEVANTKRR RLRVKKRAKEEVVVNEAIYGLIS | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,146.584 | ||
Theoretical pI: | 11.107 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 46.850 | ||
aromaticity | 0.063 | ||
GRAVY | 0.186 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.301 | ||
sheet | 0.238 |