| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143188.1 | internal | 190 | 1-570(+) |
Amino Acid sequence : | |||
| GLTYETGDHVGVYSENCIETVEEAEKLLGYSPDTFFSIHADNEDGGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRS LLEVMAEFPSVKPPLGVFFAAISPRLQPRYYSISSSPRMAPTRVHVTCALVHGPTPTGRIHKGICSTWMK | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 20,514.035 | ||
| Theoretical pI: | 6.322 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 50.716 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.162 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.279 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143188.1 | internal | 190 | 1-570(+) |
Amino Acid sequence : | |||
| GLTYETGDHVGVYSENCIETVEEAEKLLGYSPDTFFSIHADNEDGGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRS LLEVMAEFPSVKPPLGVFFAAISPRLQPRYYSISSSPRMAPTRVHVTCALVHGPTPTGRIHKGICSTWMK | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 20,514.035 | ||
| Theoretical pI: | 6.322 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 50.716 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.162 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.279 | ||
| sheet | 0.274 | ||