| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143194.1 | complete | 129 | 62-451(+) |
Amino Acid sequence : | |||
| MDGTEMAGTSGSVGNKRRRDEDGDSFSKEADETHGLENTLTFSDTLVALQMMRTQFPKLEKIAIKPFILRSQLYSSVKDRTQVDRDLEITIRCNSMVYCFNSMISEQASVSDSLLWEVKF KTSIYNVLK* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 14,673.495 | ||
| Theoretical pI: | 5.436 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 35.447 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.435 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.217 | ||
| sheet | 0.240 | ||