Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143194.1 | complete | 129 | 62-451(+) |
Amino Acid sequence : | |||
MDGTEMAGTSGSVGNKRRRDEDGDSFSKEADETHGLENTLTFSDTLVALQMMRTQFPKLEKIAIKPFILRSQLYSSVKDRTQVDRDLEITIRCNSMVYCFNSMISEQASVSDSLLWEVKF KTSIYNVLK* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,673.495 | ||
Theoretical pI: | 5.436 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 35.447 | ||
aromaticity | 0.078 | ||
GRAVY | -0.435 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.217 | ||
sheet | 0.240 |