| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143199.1 | internal | 200 | 2-601(+) |
Amino Acid sequence : | |||
| WECKTLPINLVFSYVNDVSISGISSINSKFFHMMIYKCNNMDIRKITIDAPANSPNTDGIHVAGSSNVSIADSTIGTGDDCVSVGDNTKKLTITGVKCGPGHGISVGSLGKNPDEGDVVG FTVKNCVMTGTMNGIRIKTWKSKPSTAYSSLRLTDFTIENIVMNNVQNPIVIDQEYCPYSACPESAPSRIKISHVAFRNI | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 10,732.680 | ||
| Theoretical pI: | 5.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 61.437 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.742 | ||
Secondary Structure Fraction | |||
| Helix | 0.384 | ||
| turn | 0.313 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143199.1 | 5prime_partial | 127 | 601-218(-) |
Amino Acid sequence : | |||
| NVSEGHVANLDARRSRFRTSRIGAILLIDDDGILNIIHDDVFNGEIGEPQATVSGRWFRFPCLDSYAIHGSGHDAVLYGESDHVSLVGILAKTSDTDAVAGTAFYASNRKLLSVVPDRDT VVACTDG* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 10,732.680 | ||
| Theoretical pI: | 5.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 61.437 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.742 | ||
Secondary Structure Fraction | |||
| Helix | 0.384 | ||
| turn | 0.313 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143199.1 | complete | 99 | 405-106(-) |
Amino Acid sequence : | |||
| MPFMVPVMTQFFTVNPTTSPSSGFLPRLPTLMPWPGPHFTPVIVSFLVLSPTETQSSPVPMVESAILTLDDPATWIPSVLGLFAGASIVILRISMLLHL* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,732.680 | ||
| Theoretical pI: | 5.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 61.437 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.742 | ||
Secondary Structure Fraction | |||
| Helix | 0.384 | ||
| turn | 0.313 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143199.1 | internal | 200 | 2-601(+) |
Amino Acid sequence : | |||
| WECKTLPINLVFSYVNDVSISGISSINSKFFHMMIYKCNNMDIRKITIDAPANSPNTDGIHVAGSSNVSIADSTIGTGDDCVSVGDNTKKLTITGVKCGPGHGISVGSLGKNPDEGDVVG FTVKNCVMTGTMNGIRIKTWKSKPSTAYSSLRLTDFTIENIVMNNVQNPIVIDQEYCPYSACPESAPSRIKISHVAFRNI | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 10,732.680 | ||
| Theoretical pI: | 5.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 61.437 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.742 | ||
Secondary Structure Fraction | |||
| Helix | 0.384 | ||
| turn | 0.313 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143199.1 | 5prime_partial | 127 | 601-218(-) |
Amino Acid sequence : | |||
| NVSEGHVANLDARRSRFRTSRIGAILLIDDDGILNIIHDDVFNGEIGEPQATVSGRWFRFPCLDSYAIHGSGHDAVLYGESDHVSLVGILAKTSDTDAVAGTAFYASNRKLLSVVPDRDT VVACTDG* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 10,732.680 | ||
| Theoretical pI: | 5.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 61.437 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.742 | ||
Secondary Structure Fraction | |||
| Helix | 0.384 | ||
| turn | 0.313 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143199.1 | complete | 99 | 405-106(-) |
Amino Acid sequence : | |||
| MPFMVPVMTQFFTVNPTTSPSSGFLPRLPTLMPWPGPHFTPVIVSFLVLSPTETQSSPVPMVESAILTLDDPATWIPSVLGLFAGASIVILRISMLLHL* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 10,732.680 | ||
| Theoretical pI: | 5.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 61.437 | ||
| aromaticity | 0.091 | ||
| GRAVY | 0.742 | ||
Secondary Structure Fraction | |||
| Helix | 0.384 | ||
| turn | 0.313 | ||
| sheet | 0.253 | ||