| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143206.1 | internal | 173 | 3-521(+) |
Amino Acid sequence : | |||
| KERSSTMSSKDKKPSSSGPTIRTLADLRRKPAPAMSDSDSDDPQEYYAGGEKSGMLVQDPSRSHPDPDAIFDQARQRAVADVPYEENSTSSSSRSFTGVGRLLSGETVPTAPQQPENILH TVSFWTNGFTINDGPLRRFDDPENAYFLESIKKSECPQELTPADRRSAVNVNL | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,021.600 | ||
| Theoretical pI: | 5.104 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 77.145 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.911 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.324 | ||
| sheet | 0.208 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143206.1 | internal | 173 | 3-521(+) |
Amino Acid sequence : | |||
| KERSSTMSSKDKKPSSSGPTIRTLADLRRKPAPAMSDSDSDDPQEYYAGGEKSGMLVQDPSRSHPDPDAIFDQARQRAVADVPYEENSTSSSSRSFTGVGRLLSGETVPTAPQQPENILH TVSFWTNGFTINDGPLRRFDDPENAYFLESIKKSECPQELTPADRRSAVNVNL | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 19,021.600 | ||
| Theoretical pI: | 5.104 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 77.145 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.911 | ||
Secondary Structure Fraction | |||
| Helix | 0.197 | ||
| turn | 0.324 | ||
| sheet | 0.208 | ||