Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143206.1 | internal | 173 | 3-521(+) |
Amino Acid sequence : | |||
KERSSTMSSKDKKPSSSGPTIRTLADLRRKPAPAMSDSDSDDPQEYYAGGEKSGMLVQDPSRSHPDPDAIFDQARQRAVADVPYEENSTSSSSRSFTGVGRLLSGETVPTAPQQPENILH TVSFWTNGFTINDGPLRRFDDPENAYFLESIKKSECPQELTPADRRSAVNVNL | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 19,021.600 | ||
Theoretical pI: | 5.104 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 77.145 | ||
aromaticity | 0.064 | ||
GRAVY | -0.911 | ||
Secondary Structure Fraction | |||
Helix | 0.197 | ||
turn | 0.324 | ||
sheet | 0.208 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143206.1 | internal | 173 | 3-521(+) |
Amino Acid sequence : | |||
KERSSTMSSKDKKPSSSGPTIRTLADLRRKPAPAMSDSDSDDPQEYYAGGEKSGMLVQDPSRSHPDPDAIFDQARQRAVADVPYEENSTSSSSRSFTGVGRLLSGETVPTAPQQPENILH TVSFWTNGFTINDGPLRRFDDPENAYFLESIKKSECPQELTPADRRSAVNVNL | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 19,021.600 | ||
Theoretical pI: | 5.104 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 77.145 | ||
aromaticity | 0.064 | ||
GRAVY | -0.911 | ||
Secondary Structure Fraction | |||
Helix | 0.197 | ||
turn | 0.324 | ||
sheet | 0.208 |