| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143217.1 | 5prime_partial | 143 | 2-433(+) |
Amino Acid sequence : | |||
| GALLVDGLGDGLLLEAYDKDFDFVRNTSFNLLQGCRMRNTKTEYVSCPSCGRTLFDLQEISAEIREKTSHLPGVSIAIMGCIVNGPGEMADADFGYVGGAPGKIDLYVGKTVVKRAIAME HATEALIQLIKDHGRWVDPSAEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 15,492.501 | ||
| Theoretical pI: | 4.920 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 31.173 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.059 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.224 | ||
| sheet | 0.280 | ||