| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143218.1 | internal | 228 | 2-685(+) |
Amino Acid sequence : | |||
| HEVGSKMNETDVAKQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKQKQVEIRKKIEYSMQLNASRIKVLQAQDDLVNSMKEAAGKELLHASEDHHGYRKLL KELIVQSLLRLKEPAVLLRCRKDDHHLVESVLDPAKQEYAEKAKVHPPEIIVDHEVYLPPGPSHEHFHLPFSHHHEHGPFCSGGVVLASRDGKIVLENSLDARLDVAF | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 26,262.628 | ||
| Theoretical pI: | 6.218 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 44.335 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.654 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.162 | ||
| sheet | 0.320 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143218.1 | internal | 228 | 2-685(+) |
Amino Acid sequence : | |||
| HEVGSKMNETDVAKQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKQKQVEIRKKIEYSMQLNASRIKVLQAQDDLVNSMKEAAGKELLHASEDHHGYRKLL KELIVQSLLRLKEPAVLLRCRKDDHHLVESVLDPAKQEYAEKAKVHPPEIIVDHEVYLPPGPSHEHFHLPFSHHHEHGPFCSGGVVLASRDGKIVLENSLDARLDVAF | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 26,262.628 | ||
| Theoretical pI: | 6.218 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 44.335 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.654 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.162 | ||
| sheet | 0.320 | ||