| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143224.1 | 5prime_partial | 127 | 1-384(+) |
Amino Acid sequence : | |||
| PVYQTEKFTKVDDERRVKVAVVTQGGMLDLGFLSFLNIFEIIERTDDSCTIRSSLEYEVDDEHADAAKLASTASLAMIAKAIVKHLLENEKEGCMKVMSSKLCFDYKLWFKRLFQSKARG VKISDAM* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,404.539 | ||
| Theoretical pI: | 6.191 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 40.946 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.142 | ||
| sheet | 0.299 | ||