Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143224.1 | 5prime_partial | 127 | 1-384(+) |
Amino Acid sequence : | |||
PVYQTEKFTKVDDERRVKVAVVTQGGMLDLGFLSFLNIFEIIERTDDSCTIRSSLEYEVDDEHADAAKLASTASLAMIAKAIVKHLLENEKEGCMKVMSSKLCFDYKLWFKRLFQSKARG VKISDAM* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 14,404.539 | ||
Theoretical pI: | 6.191 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 40.946 | ||
aromaticity | 0.087 | ||
GRAVY | -0.131 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.142 | ||
sheet | 0.299 |