Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143228.1 | 5prime_partial | 150 | 1-453(+) |
Amino Acid sequence : | |||
NGMKPDGTLEASMLQASEVWPGVTYALAATMIQEGMVETAFKTAQGVYEAAWSRNGLGYSFQVPEAWNGNDQYRALNYMRPLSIWAMQWALSPPKLHKEEQRADDRGNSSLHNMEFSKIA EMLKLPEENTSRTSLGILYDIIREKFFPRA* | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,994.064 | ||
Theoretical pI: | 5.429 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36440 | ||
Instability index: | 28.473 | ||
aromaticity | 0.107 | ||
GRAVY | -0.484 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.247 | ||
sheet | 0.333 |