| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143241.1 | internal | 181 | 3-545(+) |
Amino Acid sequence : | |||
| RTPFTFLRGDQRIGLFRYRKFPSAILHVSVVRSGLERKTNKAIGGGVLMETNGSVIEEVVDKKSAVGGGVQDAYGEDRATEDLLITPWSVTVASGYSLMRDPHHNKGLAFTEKERDAHYL RGLLPPMVASQELQEKKMMHNLRQYEVPLQRYVAMMDLQERNERLFYKLLIDNVEELLPVV | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 20,631.502 | ||
| Theoretical pI: | 8.131 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 52.977 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.370 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.204 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143241.1 | internal | 181 | 3-545(+) |
Amino Acid sequence : | |||
| RTPFTFLRGDQRIGLFRYRKFPSAILHVSVVRSGLERKTNKAIGGGVLMETNGSVIEEVVDKKSAVGGGVQDAYGEDRATEDLLITPWSVTVASGYSLMRDPHHNKGLAFTEKERDAHYL RGLLPPMVASQELQEKKMMHNLRQYEVPLQRYVAMMDLQERNERLFYKLLIDNVEELLPVV | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 20,631.502 | ||
| Theoretical pI: | 8.131 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 52.977 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.370 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.204 | ||
| sheet | 0.293 | ||