Acc_NO	ORF type	length	start-end position (strand +/-)
>EX143243.1	internal	235	706-2(-)
Amino Acid sequence :
KHNKIFLFKTLTSNITSFQDTHYRLTHNKTTTLLMPPPQHIYLFLRHTTHKRGNNQPQDDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFP LLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILIVLIC
Physicochemical properties
Number of amino acids:		235
Molecular weight:		18,640.885
Theoretical pI:		6.982
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16500
Instability index:		55.787
aromaticity		0.086
GRAVY		-0.660
Secondary Structure Fraction
Helix		0.276
turn		0.239
sheet		0.221

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX143243.1	5prime_partial	163	3-494(+)
Amino Acid sequence :
QIKTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLR RFRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG*
Physicochemical properties
Number of amino acids:		163
Molecular weight:		18,640.885
Theoretical pI:		6.982
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16500
Instability index:		55.787
aromaticity		0.086
GRAVY		-0.660
Secondary Structure Fraction
Helix		0.276
turn		0.239
sheet		0.221