| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143245.1 | internal | 147 | 1-441(+) |
Amino Acid sequence : | |||
| AKFDSFFGLFSIKMSIISFPTSCTIKCNFRTQSPYALAKGPTSLGSFKNVSKSFGLKQSSCFKATAMAVYKVKLVTPEGEEHEFEAPDDAYILDSAETAGLELPYSCRAGACSTCAGKIV SGSVDQSDGSFLDESQVENGYALTCVS | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 15,666.528 | ||
| Theoretical pI: | 5.128 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7825 | ||
| Instability index: | 44.827 | ||
| aromaticity | 0.109 | ||
| GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.279 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143245.1 | internal | 147 | 1-441(+) |
Amino Acid sequence : | |||
| AKFDSFFGLFSIKMSIISFPTSCTIKCNFRTQSPYALAKGPTSLGSFKNVSKSFGLKQSSCFKATAMAVYKVKLVTPEGEEHEFEAPDDAYILDSAETAGLELPYSCRAGACSTCAGKIV SGSVDQSDGSFLDESQVENGYALTCVS | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 15,666.528 | ||
| Theoretical pI: | 5.128 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7825 | ||
| Instability index: | 44.827 | ||
| aromaticity | 0.109 | ||
| GRAVY | -0.022 | ||
Secondary Structure Fraction | |||
| Helix | 0.272 | ||
| turn | 0.279 | ||
| sheet | 0.238 | ||