| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143259.1 | internal | 193 | 1-579(+) |
Amino Acid sequence : | |||
| SPGLQEFGTRQELSFIRDQPLKWYTWSMTMLPDPQFSKCRIYLTKVIAFVYIIDDIFDTYGTLEELSLFTEAIRKWELSAMGTLPTYMQICYKTLYNITNEIAEATKEECNWHPIDYLKE SWARLCDAFLNEAKWFQSKKMPKSDEYLKNAIVSSGLCTVLLHVYFLLGQGITQENANFLMTSPTLLSSPATI | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 22,362.544 | ||
| Theoretical pI: | 5.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48150 | ||
| Instability index: | 41.381 | ||
| aromaticity | 0.135 | ||
| GRAVY | -0.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.192 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143259.1 | internal | 193 | 1-579(+) |
Amino Acid sequence : | |||
| SPGLQEFGTRQELSFIRDQPLKWYTWSMTMLPDPQFSKCRIYLTKVIAFVYIIDDIFDTYGTLEELSLFTEAIRKWELSAMGTLPTYMQICYKTLYNITNEIAEATKEECNWHPIDYLKE SWARLCDAFLNEAKWFQSKKMPKSDEYLKNAIVSSGLCTVLLHVYFLLGQGITQENANFLMTSPTLLSSPATI | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 22,362.544 | ||
| Theoretical pI: | 5.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48150 | ||
| Instability index: | 41.381 | ||
| aromaticity | 0.135 | ||
| GRAVY | -0.108 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.192 | ||
| sheet | 0.280 | ||