Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143259.1 | internal | 193 | 1-579(+) |
Amino Acid sequence : | |||
SPGLQEFGTRQELSFIRDQPLKWYTWSMTMLPDPQFSKCRIYLTKVIAFVYIIDDIFDTYGTLEELSLFTEAIRKWELSAMGTLPTYMQICYKTLYNITNEIAEATKEECNWHPIDYLKE SWARLCDAFLNEAKWFQSKKMPKSDEYLKNAIVSSGLCTVLLHVYFLLGQGITQENANFLMTSPTLLSSPATI | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 22,362.544 | ||
Theoretical pI: | 5.099 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48150 | ||
Instability index: | 41.381 | ||
aromaticity | 0.135 | ||
GRAVY | -0.108 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.192 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143259.1 | internal | 193 | 1-579(+) |
Amino Acid sequence : | |||
SPGLQEFGTRQELSFIRDQPLKWYTWSMTMLPDPQFSKCRIYLTKVIAFVYIIDDIFDTYGTLEELSLFTEAIRKWELSAMGTLPTYMQICYKTLYNITNEIAEATKEECNWHPIDYLKE SWARLCDAFLNEAKWFQSKKMPKSDEYLKNAIVSSGLCTVLLHVYFLLGQGITQENANFLMTSPTLLSSPATI | |||
Physicochemical properties | |||
Number of amino acids: | 193 | ||
Molecular weight: | 22,362.544 | ||
Theoretical pI: | 5.099 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 47900 48150 | ||
Instability index: | 41.381 | ||
aromaticity | 0.135 | ||
GRAVY | -0.108 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.192 | ||
sheet | 0.280 |