Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143267.1 | internal | 223 | 2-670(+) |
Amino Acid sequence : | |||
HEHKVESNGNRPKVSMAAASEVGNCLGWAARDASGTLSPHKFDRRVTGSDDVSIKITHCGVCYADVAWTQNRMRDSIYPLVPGHEIVGVVTEIGSSVSHFKIGDNIGVGTYVNSCRDCEN CNEYIENHCSKGGLVLTFNGKDSDGTVTKGGYSSYIVVHERYCFKIPDGYPLAMAAPLLCAGITVYTPMMHHNMKQPGKSLGVIGLGGLGHMAVKFGKAFGLK | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 23,937.054 | ||
Theoretical pI: | 8.098 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24910 | ||
Instability index: | 26.290 | ||
aromaticity | 0.076 | ||
GRAVY | -0.162 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.291 | ||
sheet | 0.188 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143267.1 | internal | 223 | 2-670(+) |
Amino Acid sequence : | |||
HEHKVESNGNRPKVSMAAASEVGNCLGWAARDASGTLSPHKFDRRVTGSDDVSIKITHCGVCYADVAWTQNRMRDSIYPLVPGHEIVGVVTEIGSSVSHFKIGDNIGVGTYVNSCRDCEN CNEYIENHCSKGGLVLTFNGKDSDGTVTKGGYSSYIVVHERYCFKIPDGYPLAMAAPLLCAGITVYTPMMHHNMKQPGKSLGVIGLGGLGHMAVKFGKAFGLK | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 23,937.054 | ||
Theoretical pI: | 8.098 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24910 | ||
Instability index: | 26.290 | ||
aromaticity | 0.076 | ||
GRAVY | -0.162 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.291 | ||
sheet | 0.188 |