| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143269.1 | 3prime_partial | 192 | 578-3(-) |
Amino Acid sequence : | |||
| MPPQPILFILEAHHSQKREQPQDDQRTARINDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFL IPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDDEGSNTREPNPNGTSDILT | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 18,227.373 | ||
| Theoretical pI: | 6.254 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 57.527 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.641 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.244 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143269.1 | 5prime_partial | 160 | 1-483(+) |
Amino Acid sequence : | |||
| AVKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFR MPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 18,227.373 | ||
| Theoretical pI: | 6.254 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 57.527 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.641 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.244 | ||
| sheet | 0.231 | ||