| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143273.1 | internal | 143 | 1-429(+) |
Amino Acid sequence : | |||
| EEEEMASSPSKTLLNILNPAKRIKTLSPETLIPKSSISTPSPIDGSPSNLTSEQRTRMEVNKSMARWKRNLTLCTARIEKSKAEGMDYLKLEELLVEETWLEALPGELKKPYAKNLCKFV EREIRGSIPIYPPPCLIFNALNS | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,131.530 | ||
| Theoretical pI: | 8.471 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 72.102 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.490 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.280 | ||
| sheet | 0.329 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143273.1 | internal | 143 | 1-429(+) |
Amino Acid sequence : | |||
| EEEEMASSPSKTLLNILNPAKRIKTLSPETLIPKSSISTPSPIDGSPSNLTSEQRTRMEVNKSMARWKRNLTLCTARIEKSKAEGMDYLKLEELLVEETWLEALPGELKKPYAKNLCKFV EREIRGSIPIYPPPCLIFNALNS | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,131.530 | ||
| Theoretical pI: | 8.471 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 72.102 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.490 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.280 | ||
| sheet | 0.329 | ||