| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143287.1 | internal | 133 | 2-400(+) |
Amino Acid sequence : | |||
| GGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGA CRHLPRTSQDVCR | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,728.828 | ||
| Theoretical pI: | 7.986 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 44.862 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.293 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143287.1 | internal | 133 | 3-401(+) |
Amino Acid sequence : | |||
| VAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLRSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKEL AGISPGLVRMSVG | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,728.828 | ||
| Theoretical pI: | 7.986 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 44.862 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.293 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143287.1 | internal | 133 | 2-400(+) |
Amino Acid sequence : | |||
| GGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEHSGQGA CRHLPRTSQDVCR | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,728.828 | ||
| Theoretical pI: | 7.986 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 44.862 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.293 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143287.1 | internal | 133 | 3-401(+) |
Amino Acid sequence : | |||
| VAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLRSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKEL AGISPGLVRMSVG | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,728.828 | ||
| Theoretical pI: | 7.986 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 44.862 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.293 | ||
| sheet | 0.331 | ||