Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143288.1 | internal | 178 | 3-536(+) |
Amino Acid sequence : | |||
TEAWTGWFTGFGGPIPHRPAEDMAFAVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLLNEPKWGHLRDLHKAIKMSEPALVSGDPAVTSLGNSQQAFVYRSGKG DCAAFLSNNDESSSATVTFNGGRYIIPPWSVSILPDCKNVVYNTAKVGVPSSQMKMQW | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 19,418.572 | ||
Theoretical pI: | 6.371 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41035 | ||
Instability index: | 44.461 | ||
aromaticity | 0.135 | ||
GRAVY | -0.296 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.315 | ||
sheet | 0.191 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143288.1 | internal | 178 | 3-536(+) |
Amino Acid sequence : | |||
TEAWTGWFTGFGGPIPHRPAEDMAFAVAKFIQKGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPIDEYGLLNEPKWGHLRDLHKAIKMSEPALVSGDPAVTSLGNSQQAFVYRSGKG DCAAFLSNNDESSSATVTFNGGRYIIPPWSVSILPDCKNVVYNTAKVGVPSSQMKMQW | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 19,418.572 | ||
Theoretical pI: | 6.371 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 41035 | ||
Instability index: | 44.461 | ||
aromaticity | 0.135 | ||
GRAVY | -0.296 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.315 | ||
sheet | 0.191 |