| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143295.1 | complete | 118 | 55-411(+) |
Amino Acid sequence : | |||
| MARQVALCTILVIAAVLFISSPRAESAVSCSTVASAISPCIGYVRGQGALTGACCSGVKGLAAAAATTPDRRTACSCLKSMAGKISGLNPSLAKGLPGKCGASVPYVISTSTDCTKVA* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 11,611.565 | ||
| Theoretical pI: | 9.254 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3480 | ||
| Instability index: | 42.828 | ||
| aromaticity | 0.025 | ||
| GRAVY | 0.602 | ||
Secondary Structure Fraction | |||
| Helix | 0.246 | ||
| turn | 0.280 | ||
| sheet | 0.271 | ||