| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143303.1 | internal | 187 | 1-561(+) |
Amino Acid sequence : | |||
| GLTYETGDHVGVYSENCIETVEEAEKLLGYSPDTFFSIHADNEDGGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRS LLEVMAEFPSVKPPLGVFFAAISPRLQPRYYSISSSPRMAPTRVHVTCALVHGPTPTGRIHKGICST | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 20,068.457 | ||
| Theoretical pI: | 6.070 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
| Instability index: | 50.906 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.283 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143303.1 | internal | 187 | 1-561(+) |
Amino Acid sequence : | |||
| GLTYETGDHVGVYSENCIETVEEAEKLLGYSPDTFFSIHADNEDGGPVSGGTLPPPFASPCTLRTALTRYADLLSSPKKAALVALAAHASESNEAERLKFLASPAGKDDYSQWVFASQRS LLEVMAEFPSVKPPLGVFFAAISPRLQPRYYSISSSPRMAPTRVHVTCALVHGPTPTGRIHKGICST | |||
Physicochemical properties | |||
| Number of amino acids: | 187 | ||
| Molecular weight: | 20,068.457 | ||
| Theoretical pI: | 6.070 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
| Instability index: | 50.906 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.283 | ||
| sheet | 0.273 | ||