| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143324.1 | 5prime_partial | 102 | 3-311(+) |
Amino Acid sequence : | |||
| KHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,704.892 | ||
| Theoretical pI: | 4.921 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 20.482 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.190 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.275 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143324.1 | 5prime_partial | 102 | 3-311(+) |
Amino Acid sequence : | |||
| KHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVSGQNLVVDGGYSVGNPSINAF* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,704.892 | ||
| Theoretical pI: | 4.921 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 20.482 | ||
| aromaticity | 0.078 | ||
| GRAVY | 0.190 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.275 | ||
| sheet | 0.265 | ||