| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143359.1 | internal | 215 | 2-646(+) |
Amino Acid sequence : | |||
| HEVGSKMNETDVAKQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKQKQVEIRKKIEYSMQLNASRIKVLQAQDDLVNSMKEAAGKELLHASEDHHGYRKLL KELIVQSLLRLKEPAVLLRCRKDDHHLVESVLDPAKQEYAEKAKVHPPEIIVDHEVYLPPGPSHEHFHLPFSHHHEHGPFCSGGVVLASRDGKIV | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 24,818.040 | ||
| Theoretical pI: | 6.452 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 46.411 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.706 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.163 | ||
| sheet | 0.312 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143359.1 | internal | 215 | 2-646(+) |
Amino Acid sequence : | |||
| HEVGSKMNETDVAKQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKQKQVEIRKKIEYSMQLNASRIKVLQAQDDLVNSMKEAAGKELLHASEDHHGYRKLL KELIVQSLLRLKEPAVLLRCRKDDHHLVESVLDPAKQEYAEKAKVHPPEIIVDHEVYLPPGPSHEHFHLPFSHHHEHGPFCSGGVVLASRDGKIV | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 24,818.040 | ||
| Theoretical pI: | 6.452 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 46.411 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.706 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.163 | ||
| sheet | 0.312 | ||