| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143364.1 | 5prime_partial | 166 | 2-502(+) |
Amino Acid sequence : | |||
| ELYKGTTKKMKISREIADSSGRTVPVEEILTIEIKPGWKKGTKITFPEKGNERPNVAPADLVFIIDEKSHPVFTRDGNDLIATQKVSLAEALTGYTVQLTTLDGRSLTIPINSIISPQYE EVVPREGMPIPKDPSRKGNLRIKFNIKFPTRLTSEQKAGIKRLLAP* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 18,481.196 | ||
| Theoretical pI: | 9.629 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 46.206 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.444 | ||
Secondary Structure Fraction | |||
| Helix | 0.289 | ||
| turn | 0.247 | ||
| sheet | 0.217 | ||