| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143371.1 | internal | 128 | 384-1(-) |
Amino Acid sequence : | |||
| NIETLFYTIGPPFRYSVKAKATRPSMANLPFHNSASAVITPSDLDCTVTPFKSGINEAAENTAAVKTNHGIPPFASCTARSSPLANSTATAATNPTMANRPLILSGAGPLNANTSVNFVL TLGVLGGG | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 12,582.579 | ||
| Theoretical pI: | 8.722 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 14.940 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.535 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.248 | ||
| sheet | 0.322 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143371.1 | 5prime_partial | 121 | 2-367(+) |
Amino Acid sequence : | |||
| PPPRTPKVSTKFTDVLAFSGPAPERINGRLAMVGFVAAVAVELARGDDLAVQLANGGIPWFVLTAAVFSAASLIPLLKGVTVQSKSDGVMTADAELWNGRFAMLGLVALAFTEYLKGGPI V* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 12,582.579 | ||
| Theoretical pI: | 8.722 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 14.940 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.535 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.248 | ||
| sheet | 0.322 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143371.1 | internal | 128 | 384-1(-) |
Amino Acid sequence : | |||
| NIETLFYTIGPPFRYSVKAKATRPSMANLPFHNSASAVITPSDLDCTVTPFKSGINEAAENTAAVKTNHGIPPFASCTARSSPLANSTATAATNPTMANRPLILSGAGPLNANTSVNFVL TLGVLGGG | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 12,582.579 | ||
| Theoretical pI: | 8.722 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 14.940 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.535 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.248 | ||
| sheet | 0.322 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143371.1 | 5prime_partial | 121 | 2-367(+) |
Amino Acid sequence : | |||
| PPPRTPKVSTKFTDVLAFSGPAPERINGRLAMVGFVAAVAVELARGDDLAVQLANGGIPWFVLTAAVFSAASLIPLLKGVTVQSKSDGVMTADAELWNGRFAMLGLVALAFTEYLKGGPI V* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 12,582.579 | ||
| Theoretical pI: | 8.722 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 14.940 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.535 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.248 | ||
| sheet | 0.322 | ||