Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143377.1 | 5prime_partial | 179 | 3-542(+) |
Amino Acid sequence : | |||
TRELLREQISPSKICSQIGVCTSDGAKSISTVIETVVEKGSKEKSSIKNDVFCAACEMAVVWISNQLRENQTRDRILEYANEVCERLPSPAGESAVDCDQLASMPNISFTIANKIFTLTP KEYVLKLEEQGTTMCLSGFMAFDLPAPRGPLWILGDVFMGAYHTVFDFEDYKIGFAKAA* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 19,775.469 | ||
Theoretical pI: | 4.900 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
Instability index: | 47.169 | ||
aromaticity | 0.084 | ||
GRAVY | -0.054 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.218 | ||
sheet | 0.268 |