| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143391.1 | internal | 185 | 3-557(+) |
Amino Acid sequence : | |||
| RRISLSEQQLAKAVASHGADIVKFTQKNILRVYPKGTRFNSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGFYRANGGCGYVKKPDFLQHTGPHGEVFDPKASLPAKKTLKVKVYMGD GWRMDFKQTHFYAYSPPDFYTRVGIAGVPADSIMKKTRAIEDDWTPVWNEEFDFPLTVPELALLR | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 21,077.985 | ||
| Theoretical pI: | 9.566 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 40910 | ||
| Instability index: | 49.136 | ||
| aromaticity | 0.135 | ||
| GRAVY | -0.411 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.238 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143391.1 | internal | 185 | 3-557(+) |
Amino Acid sequence : | |||
| RRISLSEQQLAKAVASHGADIVKFTQKNILRVYPKGTRFNSSNYNPLIGWMHGAQMVAFNMQGYGRSLWLMHGFYRANGGCGYVKKPDFLQHTGPHGEVFDPKASLPAKKTLKVKVYMGD GWRMDFKQTHFYAYSPPDFYTRVGIAGVPADSIMKKTRAIEDDWTPVWNEEFDFPLTVPELALLR | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 21,077.985 | ||
| Theoretical pI: | 9.566 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40910 40910 | ||
| Instability index: | 49.136 | ||
| aromaticity | 0.135 | ||
| GRAVY | -0.411 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.238 | ||
| sheet | 0.216 | ||