Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143395.1 | internal | 160 | 3-482(+) |
Amino Acid sequence : | |||
ILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDASTSHSNNGI DEGNAQQSYQMDMSNISSTSTDAFAVPMFSTESSENFWTV | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 18,503.531 | ||
Theoretical pI: | 9.100 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40450 | ||
Instability index: | 53.071 | ||
aromaticity | 0.088 | ||
GRAVY | -0.828 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.275 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143395.1 | internal | 160 | 3-482(+) |
Amino Acid sequence : | |||
ILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQNQQMMMVDDASTSHSNNGI DEGNAQQSYQMDMSNISSTSTDAFAVPMFSTESSENFWTV | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 18,503.531 | ||
Theoretical pI: | 9.100 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40450 | ||
Instability index: | 53.071 | ||
aromaticity | 0.088 | ||
GRAVY | -0.828 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.275 | ||
sheet | 0.219 |