| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143397.1 | internal | 184 | 2-553(+) |
Amino Acid sequence : | |||
| NEGFYFNDQETDPTMGKSYPTVSAEYLKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTFDCKSKTGGPFGTMRHKAELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVE ITGGPDVPFHPGREDKPEPPVEGRLPDATKGCDHLRTVFGEQMGLSDKDIVALSGGHTLGRCHK | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 14,977.148 | ||
| Theoretical pI: | 10.004 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 44.233 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.231 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143397.1 | 3prime_partial | 130 | 391-2(-) |
Amino Acid sequence : | |||
| MERDIRASSNFHSNNTSKLIKISIGDDRELLLDRFQEPDGNIKTIVRSVSELRLMPHRPERTSGLRLTIESSGRVPCYSEHQRSTVLLGDKSTELPLALLHRLEVLRAHGRVRLPHRRIC FLIVEIKSFV | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,977.148 | ||
| Theoretical pI: | 10.004 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 44.233 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.231 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143397.1 | internal | 184 | 2-553(+) |
Amino Acid sequence : | |||
| NEGFYFNDQETDPTMGKSYPTVSAEYLKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTFDCKSKTGGPFGTMRHKAELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVVAVE ITGGPDVPFHPGREDKPEPPVEGRLPDATKGCDHLRTVFGEQMGLSDKDIVALSGGHTLGRCHK | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 14,977.148 | ||
| Theoretical pI: | 10.004 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 44.233 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.231 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143397.1 | 3prime_partial | 130 | 391-2(-) |
Amino Acid sequence : | |||
| MERDIRASSNFHSNNTSKLIKISIGDDRELLLDRFQEPDGNIKTIVRSVSELRLMPHRPERTSGLRLTIESSGRVPCYSEHQRSTVLLGDKSTELPLALLHRLEVLRAHGRVRLPHRRIC FLIVEIKSFV | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,977.148 | ||
| Theoretical pI: | 10.004 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 44.233 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.373 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.231 | ||
| sheet | 0.254 | ||