| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143401.1 | internal | 193 | 2-580(+) |
Amino Acid sequence : | |||
| HEEEWGFFQLVNHGIPKELLDRVKKVCSECYKLDRERKFKESEPVQLLNELVGSGETGGRVDDVDWEDVFVLQDNNEWPANPPEFKKTMKEYREELKKLAEKVMEVMEENLGLAKGHMKH SFSGTDAPFFGTKVSHYPPCPHPDKVNGLRAHTDAGGVILLFQDDEVSGLQILKDGEWIDVEPMADAIVINTG | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,941.159 | ||
| Theoretical pI: | 5.183 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 43.872 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.249 | ||
Secondary Structure Fraction | |||
| Helix | 0.415 | ||
| turn | 0.161 | ||
| sheet | 0.337 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143401.1 | internal | 193 | 580-2(-) |
Amino Acid sequence : | |||
| PGVDHDRVGHGLHVDPLPVFEYLEATDLIVLEEEDDAPRVGMGPEAVDFVRVRAGGVVADFRAEERRVRAGERMLHVPLCETEVLFHHFHYLLRELLQFFSVLLHGFFELRWICRPLVVI LQYKHIFPVHVIDPTTGLAATDQLVQQLNGLGLLELSLPIQLVALRANLLNAVEELFRNPVVHQLEESPLFLV | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,941.159 | ||
| Theoretical pI: | 5.183 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 43.872 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.249 | ||
Secondary Structure Fraction | |||
| Helix | 0.415 | ||
| turn | 0.161 | ||
| sheet | 0.337 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143401.1 | internal | 193 | 2-580(+) |
Amino Acid sequence : | |||
| HEEEWGFFQLVNHGIPKELLDRVKKVCSECYKLDRERKFKESEPVQLLNELVGSGETGGRVDDVDWEDVFVLQDNNEWPANPPEFKKTMKEYREELKKLAEKVMEVMEENLGLAKGHMKH SFSGTDAPFFGTKVSHYPPCPHPDKVNGLRAHTDAGGVILLFQDDEVSGLQILKDGEWIDVEPMADAIVINTG | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,941.159 | ||
| Theoretical pI: | 5.183 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 43.872 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.249 | ||
Secondary Structure Fraction | |||
| Helix | 0.415 | ||
| turn | 0.161 | ||
| sheet | 0.337 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143401.1 | internal | 193 | 580-2(-) |
Amino Acid sequence : | |||
| PGVDHDRVGHGLHVDPLPVFEYLEATDLIVLEEEDDAPRVGMGPEAVDFVRVRAGGVVADFRAEERRVRAGERMLHVPLCETEVLFHHFHYLLRELLQFFSVLLHGFFELRWICRPLVVI LQYKHIFPVHVIDPTTGLAATDQLVQQLNGLGLLELSLPIQLVALRANLLNAVEELFRNPVVHQLEESPLFLV | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,941.159 | ||
| Theoretical pI: | 5.183 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 43.872 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.249 | ||
Secondary Structure Fraction | |||
| Helix | 0.415 | ||
| turn | 0.161 | ||
| sheet | 0.337 | ||