| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143404.1 | internal | 103 | 2-310(+) |
Amino Acid sequence : | |||
| KKYYNAGDVDSSLKKIHEETQAMLMGFFIADYIPMLGWLDRLTGMRARLERNFQDFDNFYQHVIDEHIMNSKGREDQDRGAEDFLDTLLNLKKLAGTQLTNDH | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 12,071.447 | ||
| Theoretical pI: | 5.232 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 16.500 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.693 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.165 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143404.1 | internal | 103 | 2-310(+) |
Amino Acid sequence : | |||
| KKYYNAGDVDSSLKKIHEETQAMLMGFFIADYIPMLGWLDRLTGMRARLERNFQDFDNFYQHVIDEHIMNSKGREDQDRGAEDFLDTLLNLKKLAGTQLTNDH | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 12,071.447 | ||
| Theoretical pI: | 5.232 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 16.500 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.693 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.165 | ||
| sheet | 0.282 | ||