| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143410.1 | 3prime_partial | 188 | 566-3(-) |
Amino Acid sequence : | |||
| MPPQPILFILEAHHSQKREQPQDDQRTARINDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFL IPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDDEGSNTREPNPNGTS | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 17,797.796 | ||
| Theoretical pI: | 5.833 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 54.024 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.683 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.250 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143410.1 | 5prime_partial | 156 | 1-471(+) |
Amino Acid sequence : | |||
| SLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPEN AKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,797.796 | ||
| Theoretical pI: | 5.833 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 54.024 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.683 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.250 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143410.1 | 3prime_partial | 188 | 566-3(-) |
Amino Acid sequence : | |||
| MPPQPILFILEAHHSQKREQPQDDQRTARINDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFL IPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDDEGSNTREPNPNGTS | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 17,797.796 | ||
| Theoretical pI: | 5.833 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 54.024 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.683 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.250 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143410.1 | 5prime_partial | 156 | 1-471(+) |
Amino Acid sequence : | |||
| SLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRRFRMPEN AKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,797.796 | ||
| Theoretical pI: | 5.833 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 54.024 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.683 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.250 | ||
| sheet | 0.224 | ||