| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143417.1 | internal | 191 | 1-573(+) |
Amino Acid sequence : | |||
| VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEATQRLYQEASSTDKSIKLYEGFLHDLLFEPERDDIARSIIDWLRSRVDRCS | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,264.107 | ||
| Theoretical pI: | 7.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 38.663 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.241 | ||
| sheet | 0.225 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143417.1 | internal | 191 | 1-573(+) |
Amino Acid sequence : | |||
| VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEATQRLYQEASSTDKSIKLYEGFLHDLLFEPERDDIARSIIDWLRSRVDRCS | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,264.107 | ||
| Theoretical pI: | 7.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 38.663 | ||
| aromaticity | 0.079 | ||
| GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.241 | ||
| sheet | 0.225 | ||