Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143422.1 | internal | 184 | 3-554(+) |
Amino Acid sequence : | |||
ARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSS IASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFYNRTEEEVEA | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 19,624.244 | ||
Theoretical pI: | 6.400 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
Instability index: | 30.469 | ||
aromaticity | 0.060 | ||
GRAVY | 0.099 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.250 | ||
sheet | 0.245 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143422.1 | internal | 184 | 3-554(+) |
Amino Acid sequence : | |||
ARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSS IASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFYNRTEEEVEA | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 19,624.244 | ||
Theoretical pI: | 6.400 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
Instability index: | 30.469 | ||
aromaticity | 0.060 | ||
GRAVY | 0.099 | ||
Secondary Structure Fraction | |||
Helix | 0.299 | ||
turn | 0.250 | ||
sheet | 0.245 |