| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143422.1 | internal | 184 | 3-554(+) |
Amino Acid sequence : | |||
| ARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSS IASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFYNRTEEEVEA | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,624.244 | ||
| Theoretical pI: | 6.400 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 30.469 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.099 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.250 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143422.1 | internal | 184 | 3-554(+) |
Amino Acid sequence : | |||
| ARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSS IASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFYNRTEEEVEA | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,624.244 | ||
| Theoretical pI: | 6.400 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 30.469 | ||
| aromaticity | 0.060 | ||
| GRAVY | 0.099 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.250 | ||
| sheet | 0.245 | ||