| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143423.1 | internal | 166 | 3-500(+) |
Amino Acid sequence : | |||
| TRKIMSFSQNGPHSVCILSANGAISNVTLSQATTSGGTVTYEGRFEILSLSGSFLLSEIGGQRSRTGGLSVSLAGPDGRVLGGGVAGILTAASPVQVVVGSFIADRSKEPKPMNPTDPTM VSGKFSSGMMGNSSPPSRGTTMSESSGGPGSPFNQNINGHQQGLSS | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 11,075.677 | ||
| Theoretical pI: | 4.652 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 45.628 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.365 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143423.1 | 5prime_partial | 104 | 499-185(-) |
Amino Acid sequence : | |||
| LDSPCWWPLIFWLNGLPGPPEDSLIVVPRDGGLEFPIIPLENFPETIVGSVGFIGFGSFDLSAIKLPTTTCTGEAAVKIPATPPPKTRPSGPASDTLNPPVRLR* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,075.677 | ||
| Theoretical pI: | 4.652 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 45.628 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.365 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143423.1 | internal | 166 | 3-500(+) |
Amino Acid sequence : | |||
| TRKIMSFSQNGPHSVCILSANGAISNVTLSQATTSGGTVTYEGRFEILSLSGSFLLSEIGGQRSRTGGLSVSLAGPDGRVLGGGVAGILTAASPVQVVVGSFIADRSKEPKPMNPTDPTM VSGKFSSGMMGNSSPPSRGTTMSESSGGPGSPFNQNINGHQQGLSS | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 11,075.677 | ||
| Theoretical pI: | 4.652 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 45.628 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.365 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143423.1 | 5prime_partial | 104 | 499-185(-) |
Amino Acid sequence : | |||
| LDSPCWWPLIFWLNGLPGPPEDSLIVVPRDGGLEFPIIPLENFPETIVGSVGFIGFGSFDLSAIKLPTTTCTGEAAVKIPATPPPKTRPSGPASDTLNPPVRLR* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,075.677 | ||
| Theoretical pI: | 4.652 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 45.628 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.114 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.365 | ||
| sheet | 0.202 | ||