Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143431.1 | internal | 131 | 1-393(+) |
Amino Acid sequence : | |||
ARGADSRVCPSRILGFQPGEAFTVKNIANLVPPFQHGSTETSAALEFAVTSLEVPNILVIGHSRCGGIRALMSMKRGTISKSLISDWVSIAKTARLSTEAAAGNLSFEQQCRHCEKESLN GSLLNLLTYPW | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,102.017 | ||
Theoretical pI: | 8.849 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 42.931 | ||
aromaticity | 0.061 | ||
GRAVY | 0.003 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.282 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143431.1 | internal | 131 | 1-393(+) |
Amino Acid sequence : | |||
ARGADSRVCPSRILGFQPGEAFTVKNIANLVPPFQHGSTETSAALEFAVTSLEVPNILVIGHSRCGGIRALMSMKRGTISKSLISDWVSIAKTARLSTEAAAGNLSFEQQCRHCEKESLN GSLLNLLTYPW | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,102.017 | ||
Theoretical pI: | 8.849 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 42.931 | ||
aromaticity | 0.061 | ||
GRAVY | 0.003 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.282 | ||
sheet | 0.282 |