| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143431.1 | internal | 131 | 1-393(+) |
Amino Acid sequence : | |||
| ARGADSRVCPSRILGFQPGEAFTVKNIANLVPPFQHGSTETSAALEFAVTSLEVPNILVIGHSRCGGIRALMSMKRGTISKSLISDWVSIAKTARLSTEAAAGNLSFEQQCRHCEKESLN GSLLNLLTYPW | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,102.017 | ||
| Theoretical pI: | 8.849 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 42.931 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.282 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143431.1 | internal | 131 | 1-393(+) |
Amino Acid sequence : | |||
| ARGADSRVCPSRILGFQPGEAFTVKNIANLVPPFQHGSTETSAALEFAVTSLEVPNILVIGHSRCGGIRALMSMKRGTISKSLISDWVSIAKTARLSTEAAAGNLSFEQQCRHCEKESLN GSLLNLLTYPW | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,102.017 | ||
| Theoretical pI: | 8.849 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 42.931 | ||
| aromaticity | 0.061 | ||
| GRAVY | 0.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.282 | ||
| sheet | 0.282 | ||