| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143436.1 | internal | 101 | 1-303(+) |
Amino Acid sequence : | |||
| AREAEEMGLTFTKLFTRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,574.364 | ||
| Theoretical pI: | 9.015 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 25.866 | ||
| aromaticity | 0.119 | ||
| GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.158 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143436.1 | internal | 101 | 1-303(+) |
Amino Acid sequence : | |||
| AREAEEMGLTFTKLFTRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,574.364 | ||
| Theoretical pI: | 9.015 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 25.866 | ||
| aromaticity | 0.119 | ||
| GRAVY | 0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.376 | ||
| turn | 0.158 | ||
| sheet | 0.248 | ||