Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143446.1 | complete | 168 | 32-538(+) |
Amino Acid sequence : | |||
MGKGTEAFPDLGEHCEKENCNQLDFLPFTCAGCQKVFCLEHRTYKAHDCPKSEHRSRTVVICEICSLSIEKKGAEEEKAVLERHAKSADCDPTKKMTKPKCPVKRCKELLTFSNTNTCKA CNTNVCLKHRFPSDHSCTNLLLLPTMRKGANCRDTKKKLPSSQSITVS* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 18,837.669 | ||
Theoretical pI: | 8.844 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 2490 | ||
Instability index: | 40.522 | ||
aromaticity | 0.042 | ||
GRAVY | -0.637 | ||
Secondary Structure Fraction | |||
Helix | 0.190 | ||
turn | 0.208 | ||
sheet | 0.232 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143446.1 | complete | 168 | 32-538(+) |
Amino Acid sequence : | |||
MGKGTEAFPDLGEHCEKENCNQLDFLPFTCAGCQKVFCLEHRTYKAHDCPKSEHRSRTVVICEICSLSIEKKGAEEEKAVLERHAKSADCDPTKKMTKPKCPVKRCKELLTFSNTNTCKA CNTNVCLKHRFPSDHSCTNLLLLPTMRKGANCRDTKKKLPSSQSITVS* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 18,837.669 | ||
Theoretical pI: | 8.844 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 2490 | ||
Instability index: | 40.522 | ||
aromaticity | 0.042 | ||
GRAVY | -0.637 | ||
Secondary Structure Fraction | |||
Helix | 0.190 | ||
turn | 0.208 | ||
sheet | 0.232 |