Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143457.1 | internal | 171 | 2-514(+) |
Amino Acid sequence : | |||
TQLTNDHIKGMLMNIFIGGTYTSSAVVEWIFTELIKNPVAMKKAQDEVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDAN IWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGILVVELPL | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 14,357.741 | ||
Theoretical pI: | 9.001 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
Instability index: | 31.636 | ||
aromaticity | 0.142 | ||
GRAVY | 0.049 | ||
Secondary Structure Fraction | |||
Helix | 0.408 | ||
turn | 0.217 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143457.1 | complete | 120 | 430-68(-) |
Amino Acid sequence : | |||
MTLKINGTINESLRIEFIRIFPNICIPSHCKCIYNQPRFGWYVITINPTVLHCFSFVKQWSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHFVLCFLHGDWIFNELRKYPFYDCR * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 14,357.741 | ||
Theoretical pI: | 9.001 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
Instability index: | 31.636 | ||
aromaticity | 0.142 | ||
GRAVY | 0.049 | ||
Secondary Structure Fraction | |||
Helix | 0.408 | ||
turn | 0.217 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143457.1 | internal | 171 | 2-514(+) |
Amino Acid sequence : | |||
TQLTNDHIKGMLMNIFIGGTYTSSAVVEWIFTELIKNPVAMKKAQDEVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDAN IWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGILVVELPL | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 14,357.741 | ||
Theoretical pI: | 9.001 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
Instability index: | 31.636 | ||
aromaticity | 0.142 | ||
GRAVY | 0.049 | ||
Secondary Structure Fraction | |||
Helix | 0.408 | ||
turn | 0.217 | ||
sheet | 0.183 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143457.1 | complete | 120 | 430-68(-) |
Amino Acid sequence : | |||
MTLKINGTINESLRIEFIRIFPNICIPSHCKCIYNQPRFGWYVITINPTVLHCFSFVKQWSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHFVLCFLHGDWIFNELRKYPFYDCR * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 14,357.741 | ||
Theoretical pI: | 9.001 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
Instability index: | 31.636 | ||
aromaticity | 0.142 | ||
GRAVY | 0.049 | ||
Secondary Structure Fraction | |||
Helix | 0.408 | ||
turn | 0.217 | ||
sheet | 0.183 |