| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143460.1 | 5prime_partial | 203 | 1-612(+) |
Amino Acid sequence : | |||
| AREYVQLRLPQAEKPSFLAIASPPSLASSDGRFEFLIKKVAGSTAELLCGLGRGDVVEITGVMGNGFQVGRISPPDNYPTVLIFATGSGISPIRSLIESGFYANKRSDVRLYYGARNLER MAYQDRFKDWEATGVRIVPVLSRPDDRWKGEHGYIQAVFTKAKQIINPSSTGAVLCGHKQMTEDVTSVLVADGVSHDKILKNF* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 11,367.419 | ||
| Theoretical pI: | 11.642 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 115.674 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.829 | ||
Secondary Structure Fraction | |||
| Helix | 0.148 | ||
| turn | 0.491 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143460.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
| HESTSSSASPKPRSPPSSPSPRLPPSPPPTAASSSSSRRSPDRRPSCFVDLGGATWSRLQGSWGTASRSGGSRRQITIPPSSSSPPDQGSVQFVHLLSQVSMQIKDQM* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,367.419 | ||
| Theoretical pI: | 11.642 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 115.674 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.829 | ||
Secondary Structure Fraction | |||
| Helix | 0.148 | ||
| turn | 0.491 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143460.1 | 5prime_partial | 203 | 1-612(+) |
Amino Acid sequence : | |||
| AREYVQLRLPQAEKPSFLAIASPPSLASSDGRFEFLIKKVAGSTAELLCGLGRGDVVEITGVMGNGFQVGRISPPDNYPTVLIFATGSGISPIRSLIESGFYANKRSDVRLYYGARNLER MAYQDRFKDWEATGVRIVPVLSRPDDRWKGEHGYIQAVFTKAKQIINPSSTGAVLCGHKQMTEDVTSVLVADGVSHDKILKNF* | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 11,367.419 | ||
| Theoretical pI: | 11.642 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 115.674 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.829 | ||
Secondary Structure Fraction | |||
| Helix | 0.148 | ||
| turn | 0.491 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143460.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
| HESTSSSASPKPRSPPSSPSPRLPPSPPPTAASSSSSRRSPDRRPSCFVDLGGATWSRLQGSWGTASRSGGSRRQITIPPSSSSPPDQGSVQFVHLLSQVSMQIKDQM* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,367.419 | ||
| Theoretical pI: | 11.642 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 115.674 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.829 | ||
Secondary Structure Fraction | |||
| Helix | 0.148 | ||
| turn | 0.491 | ||
| sheet | 0.120 | ||