Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143461.1 | internal | 180 | 3-542(+) |
Amino Acid sequence : | |||
TSYCCGEDLLTKCAQGKTSLERFTSVVAWSISTARPVVFGLAPYNPILGETHHVSKETLNVLLEQVSHHPPVSALHATDTKENIELIWCQNPVPKFHGASIEAVIHGKRELRLKIFGEKY EMDSPNLLIRILPLPAADWVGDVTIQCKKSGLKADLSFYKIKSFLGIGGNSTSVKGKIFH | |||
Physicochemical properties | |||
Number of amino acids: | 180 | ||
Molecular weight: | 12,414.285 | ||
Theoretical pI: | 9.657 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 43.339 | ||
aromaticity | 0.104 | ||
GRAVY | -0.450 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.264 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143461.1 | 3prime_partial | 106 | 320-3(-) |
Amino Acid sequence : | |||
MNHSFNASPMELGYWVLTPDQFYILLCISCMESRYWWVMRDLLKEDIEGFFRHMMGFSKDRIIRSQTKNNRPRGRNAPCNNRSEPLKAGLPLSTLGQKVLSTTITR | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,414.285 | ||
Theoretical pI: | 9.657 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 43.339 | ||
aromaticity | 0.104 | ||
GRAVY | -0.450 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.264 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143461.1 | internal | 180 | 3-542(+) |
Amino Acid sequence : | |||
TSYCCGEDLLTKCAQGKTSLERFTSVVAWSISTARPVVFGLAPYNPILGETHHVSKETLNVLLEQVSHHPPVSALHATDTKENIELIWCQNPVPKFHGASIEAVIHGKRELRLKIFGEKY EMDSPNLLIRILPLPAADWVGDVTIQCKKSGLKADLSFYKIKSFLGIGGNSTSVKGKIFH | |||
Physicochemical properties | |||
Number of amino acids: | 180 | ||
Molecular weight: | 12,414.285 | ||
Theoretical pI: | 9.657 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 43.339 | ||
aromaticity | 0.104 | ||
GRAVY | -0.450 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.264 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143461.1 | 3prime_partial | 106 | 320-3(-) |
Amino Acid sequence : | |||
MNHSFNASPMELGYWVLTPDQFYILLCISCMESRYWWVMRDLLKEDIEGFFRHMMGFSKDRIIRSQTKNNRPRGRNAPCNNRSEPLKAGLPLSTLGQKVLSTTITR | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,414.285 | ||
Theoretical pI: | 9.657 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 43.339 | ||
aromaticity | 0.104 | ||
GRAVY | -0.450 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.264 | ||
sheet | 0.236 |