Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143476.1 | internal | 166 | 3-500(+) |
Amino Acid sequence : | |||
AWLKLFTLQKSYNKNLSQKDLQLIASSVLLAALAVTPYDHKHGASHLELENEKERNLRLTSLIGFILEPKRENREVLTRSSLLSELASKGVMTCVSQEVKDLYNLLEHEFLPLDLASKVQ PLLAKIAKLGAKLSSASSVPEVQLSQYVPALEKLTTLRVLQQVSQV | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,516.321 | ||
Theoretical pI: | 8.975 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 41.592 | ||
aromaticity | 0.048 | ||
GRAVY | -0.051 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.205 | ||
sheet | 0.367 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143476.1 | internal | 166 | 3-500(+) |
Amino Acid sequence : | |||
AWLKLFTLQKSYNKNLSQKDLQLIASSVLLAALAVTPYDHKHGASHLELENEKERNLRLTSLIGFILEPKRENREVLTRSSLLSELASKGVMTCVSQEVKDLYNLLEHEFLPLDLASKVQ PLLAKIAKLGAKLSSASSVPEVQLSQYVPALEKLTTLRVLQQVSQV | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,516.321 | ||
Theoretical pI: | 8.975 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 41.592 | ||
aromaticity | 0.048 | ||
GRAVY | -0.051 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.205 | ||
sheet | 0.367 |