| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143476.1 | internal | 166 | 3-500(+) |
Amino Acid sequence : | |||
| AWLKLFTLQKSYNKNLSQKDLQLIASSVLLAALAVTPYDHKHGASHLELENEKERNLRLTSLIGFILEPKRENREVLTRSSLLSELASKGVMTCVSQEVKDLYNLLEHEFLPLDLASKVQ PLLAKIAKLGAKLSSASSVPEVQLSQYVPALEKLTTLRVLQQVSQV | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 18,516.321 | ||
| Theoretical pI: | 8.975 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 41.592 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.051 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.205 | ||
| sheet | 0.367 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143476.1 | internal | 166 | 3-500(+) |
Amino Acid sequence : | |||
| AWLKLFTLQKSYNKNLSQKDLQLIASSVLLAALAVTPYDHKHGASHLELENEKERNLRLTSLIGFILEPKRENREVLTRSSLLSELASKGVMTCVSQEVKDLYNLLEHEFLPLDLASKVQ PLLAKIAKLGAKLSSASSVPEVQLSQYVPALEKLTTLRVLQQVSQV | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 18,516.321 | ||
| Theoretical pI: | 8.975 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 41.592 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.051 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.205 | ||
| sheet | 0.367 | ||