| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143487.1 | 5prime_partial | 117 | 2-355(+) |
Amino Acid sequence : | |||
| FIVSTTGQRDIPVSMKVFWRFLLQRNLGQQWLQGLDYAVFGLGSGYQKHNFTAKKLDKRLLDLGANPIIEKGLGDDQHPSGLHRYEVSLDPWLVSLWNTLNQMNQFYQESQIFKMLT* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,587.417 | ||
| Theoretical pI: | 9.013 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
| Instability index: | 34.462 | ||
| aromaticity | 0.128 | ||
| GRAVY | -0.335 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.231 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143487.1 | 5prime_partial | 117 | 2-355(+) |
Amino Acid sequence : | |||
| FIVSTTGQRDIPVSMKVFWRFLLQRNLGQQWLQGLDYAVFGLGSGYQKHNFTAKKLDKRLLDLGANPIIEKGLGDDQHPSGLHRYEVSLDPWLVSLWNTLNQMNQFYQESQIFKMLT* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,587.417 | ||
| Theoretical pI: | 9.013 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
| Instability index: | 34.462 | ||
| aromaticity | 0.128 | ||
| GRAVY | -0.335 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.231 | ||
| sheet | 0.222 | ||