| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143504.1 | internal | 197 | 2-592(+) |
Amino Acid sequence : | |||
| HEKDFVKRLLNKDYRKRMTASQALSHPWIQDFQEVKIPLDIMIYKLVKAYICSSSLRKSALRALAKTLTVPQLSYLREQFSLLGPTKTGYISMQNFKTALMKCSTEAMKDSKVLDFINVV CSLQYRKLDFEEFAAASISVHQLEGLDTWEQHARRGYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSD | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 22,709.045 | ||
| Theoretical pI: | 8.692 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
| Instability index: | 34.017 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.178 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143504.1 | internal | 197 | 2-592(+) |
Amino Acid sequence : | |||
| HEKDFVKRLLNKDYRKRMTASQALSHPWIQDFQEVKIPLDIMIYKLVKAYICSSSLRKSALRALAKTLTVPQLSYLREQFSLLGPTKTGYISMQNFKTALMKCSTEAMKDSKVLDFINVV CSLQYRKLDFEEFAAASISVHQLEGLDTWEQHARRGYELFEKDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSD | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 22,709.045 | ||
| Theoretical pI: | 8.692 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
| Instability index: | 34.017 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.178 | ||
| sheet | 0.284 | ||